PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004512556.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25744.3 Da    PI: 8.1854
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004512556.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.11.8e-261058250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    ri+n + rqvtfskRr+g++KKA+EL +LCda+v ++ifsstgklyey+
  XP_004512556.1 10 RIDNCTSRQVTFSKRRKGLIKKAKELAILCDAQVGLVIFSSTGKLYEYA 58
                    8***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.529161IPR002100Transcription factor, MADS-box
CDDcd002656.80E-42277No hitNo description
SuperFamilySSF554551.7E-30279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-27323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014866.9E-2681169IPR002487Transcription factor, K-box
PROSITE profilePS5129713.61485175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRGKIVIRR IDNCTSRQVT FSKRRKGLIK KAKELAILCD AQVGLVIFSS TGKLYEYANT  60
SMKSVIERYN ICKEDQQVTD PESEVKFWQR EADILRQELQ NLQENHRQLM GEQLYGLSIR  120
NLQDLENQLE LSLQGVRMKK EKILTDEIQE LDRKGNIIHQ ENVELYKKVY GTTDTTTIKH  180
AFVQFPYGVR GGGEYPQTLF QLQLCQPEQE QYCETSGSAS ATK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P3e-18169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-18169169Myocyte-specific enhancer factor 2B
1tqe_R3e-18169169Myocyte-specific enhancer factor 2B
1tqe_S3e-18169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1260104e-63AC126010.13 Medicago truncatula clone mth2-20e4, complete sequence.
GenBankEU3066594e-63EU306659.1 Medicago truncatula zinc finger protein, GH1 protein, hydroxyproline-rich glycoprotein, and bHLH transcription factor genes, complete cds; LTR-retrotransposon, complete sequence; beta-D-xylosidase, glycine-rich protein, putative protein, ABC transporter, NORK, BRICK1, oligopeptidase A, serine-hydroxymethyltransferase, and MADS-box protein genes, complete cds; tRNA-Ile genes, complete sequence; lectin gene, complete cds; LTR-retrotransposon, complete sequence; lectin genes, complete cds; and hypothetical protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004512556.11e-165PREDICTED: agamous-like MADS-box protein AGL21
SwissprotQ9SZJ69e-91AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLG7KGG11e-153G7KGG1_MEDTR; MADS-box transcription factor
STRINGGLYMA01G02525.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF8912560
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.16e-92AGAMOUS-like 21